Iright
BRAND / VENDOR: Proteintech

Proteintech, 26599-1-AP, ELOVL5 Polyclonal antibody

CATALOG NUMBER: 26599-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ELOVL5 (26599-1-AP) by Proteintech is a Polyclonal antibody targeting ELOVL5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 26599-1-AP targets ELOVL5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, mouse kidney tissue, rat kidney tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Very long-chain fatty acid elongase 5 (ELOVL5) is a key enzyme for the endogenous synthesis of long-chain unsaturated fatty acids. A critical role of ELOVL5 in elongating fatty acid substrates ranging from 16 to 20 carbons was reported in humans and rodents (PMID: 29454701). ELOVL5 is involved in metastasis through lipid droplets-regulated TGF-β receptor expression and is a predictive biomarker of metastatic ER+ breast cancer (PMID: 36056008). Western blot analysis detected ELOVL51 at an apparent molecular mass of ~25 kDa (PMID: 36056008, 32527375). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24786 Product name: Recombinant human ELOVL5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-104 aa of BC017270 Sequence: CTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD Predict reactive species Full Name: ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast) Calculated Molecular Weight: 299 aa, 35 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC017270 Gene Symbol: ELOVL5 Gene ID (NCBI): 60481 RRID: AB_3669551 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYP7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924