Proteintech, 26604-1-AP, PANX2 Polyclonal antibody

Size: 20ul / 150ul The PANX2 (26604-1-AP) by Proteintech is a Polyclonal antibody targeting PANX2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26604-1-AP targets PANX2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse spleen tissue, PC-3 cells Positive IHC detected in: human skeletal muscle tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Pannexins (Panx) are proteins homologous to the invertebrate gap junction proteins called innexins (Inx) and are traditionally described as transmembrane channels. Three distinct Panx paralogs (Panx1, Panx2 and Panx3) have been identified in vertebrates. Previous reports on Panx expression and functionality are focused primarily on Panx1 and Panx3 proteins. The exact function of Panx2 remains elusive. Catalog#26604-1-AP specially recognizes the 70 kDa Panx2. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24256 Product name: Recombinant human PANX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-170 aa of BC101023 Sequence: ESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPSANPAEPDGAAEPPVVKRPRKKMKWIPTSNPLPQPFKEPLAIMRVENSKAEKPKPARRKTATD Predict reactive species Full Name: pannexin 2 Calculated Molecular Weight: 677 aa, 74 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC101023 Gene Symbol: PANX2 Gene ID (NCBI): 56666 RRID: AB_2880572 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96RD6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.