Iright
BRAND / VENDOR: Proteintech

Proteintech, 26607-1-AP, TRDN Polyclonal antibody

CATALOG NUMBER: 26607-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRDN (26607-1-AP) by Proteintech is a Polyclonal antibody targeting TRDN in WB, ELISA applications with reactivity to human, mouse, rat samples 26607-1-AP targets TRDN in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information TRDN is a complete transmembrane protein connecting the sarcoplasmic reticulum, which has the function of triggering excitation-contraction coupling of skeletal muscle and heart and regulating heart rate. TRDN is significantly expressed in heart and skeletal muscle. Mutations in triadin can lead to malignant ventricular arrhythmias (PMID:33692971). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24294 Product name: Recombinant human TRDN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 75-293 aa of BC139910 Sequence: NFSASSIAKIGSDPLKLVRDAMEETTDWIYGFFSLLSDIISSEDEEDDDGDEDSDKGEIDEPPLRKKEIHKDKTEKQEKPERKIQTKVTHKEKEKGKEKVREKEKPEKKATHKEKIEKKEKPETKTVAKEQKKAKTAEKSEEKTKKEVKGGKQEKVKQTAAKVKEVQKTPSKPKEKEDKEKAAVSKHEQKGQSPAIPPPLPTEQASRPTPASPALEGKY Predict reactive species Full Name: triadin Calculated Molecular Weight: 729 aa, 82 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC139910 Gene Symbol: TRDN Gene ID (NCBI): 10345 RRID: AB_3085888 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13061 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924