Iright
BRAND / VENDOR: Proteintech

Proteintech, 26621-1-AP, ALDH9A1 Polyclonal antibody

CATALOG NUMBER: 26621-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ALDH9A1 (26621-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH9A1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 26621-1-AP targets ALDH9A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, HEK-293 cells Positive IHC detected in: human liver cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Aldehyde dehydrogenase 9 family member A1(ALDH9A1), belongs to the aldehyde dehydrogenase family of proteins. ALDH9A1 has a high activity for oxidation of gamma-aminobutyraldehyde and other amino aldehydes. ALDH9A1 catalyzes the dehydrogenation of gamma-aminobutyraldehyde to gamma-aminobutyric acid. ALDH9A1 has 3 isoforms with the molecular mass of 46-56 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24312 Product name: Recombinant human ALDH9A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 285-412 aa of BC151140 Sequence: LIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCV Predict reactive species Full Name: aldehyde dehydrogenase 9 family, member A1 Calculated Molecular Weight: 518 aa, 56 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC151140 Gene Symbol: ALDH9A1 Gene ID (NCBI): 223 RRID: AB_2880577 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49189 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924