Proteintech, 26630-1-AP, CLRN1 Polyclonal antibody

Size: 20ul / 150ul The CLRN1 (26630-1-AP) by Proteintech is a Polyclonal antibody targeting CLRN1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26630-1-AP targets CLRN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: mouse testis tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24289 Product name: Recombinant human CLRN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 156-232 aa of BC074970 Sequence: ASEVKIHHLSEKIANYKEGTYVYKTQSEKYTTSFWVIFFCFFVHFLNGLLIRLAGFQFPFAKSKDAETTNVAADLMY Predict reactive species Full Name: clarin 1 Calculated Molecular Weight: 232 aa, 26 kDa Observed Molecular Weight: 23 kDa, 27 kDa GenBank Accession Number: BC074970 Gene Symbol: CLRN1 Gene ID (NCBI): 7401 RRID: AB_2880579 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P58418 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.