Iright
BRAND / VENDOR: Proteintech

Proteintech, 26633-1-AP, CATSPERB Polyclonal antibody

CATALOG NUMBER: 26633-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CATSPERB (26633-1-AP) by Proteintech is a Polyclonal antibody targeting CATSPERB in WB, ELISA applications with reactivity to human, mouse samples 26633-1-AP targets CATSPERB in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: L02 cells, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information CATSPERB, also named as C14orf161 and CatSper-beta, is involved in sperm cell hyperactivation via its association with CATSPER1. CATSPERB has two isoforms with MW 127 kDa and 72 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23393 Product name: Recombinant human CATSPERB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 772-1116 aa of BC126214 Sequence: LLEVTAEVTFDDTDSYVITISAASKVLHQGSTSLAFIMWSASTECFVTTMVPTLKSSCSYLRSMHHIPSKFIPFEDWISGVHKDSQGFNLIKTLPINYRPPSNMGIAIPLTDNFYHADPSKPIPRNMFHMSKKTGKFKQCANVSTREECNCTKDQKFSHAVAFSDCREKVPRFKFPITQYPVSLEIINEDGRVPLQSPYLVTVTEVNMRHNWKLKHTVPENIKRMKQLVEPILGAAVYNPSGLNLSIKGSELFHFRVTVISGVTFCNLIEEFQIYVDEAPLPFPGHTLIAVATAVVLGGLIFIAFMFQLQGIHPWRTFQRWIRRNQEKFSSISLSELIHRSKSEE Predict reactive species Full Name: cation channel, sperm-associated, beta Observed Molecular Weight: 72 kDa GenBank Accession Number: BC126214 Gene Symbol: CATSPERB Gene ID (NCBI): 79820 RRID: AB_2880582 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H7T0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924