Iright
BRAND / VENDOR: Proteintech

Proteintech, 26635-1-AP, HELZ Polyclonal antibody

CATALOG NUMBER: 26635-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HELZ (26635-1-AP) by Proteintech is a Polyclonal antibody targeting HELZ in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 26635-1-AP targets HELZ in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24326 Product name: Recombinant human HELZ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC130582 Sequence: MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLSLGQYSMADFTGPCPLEIERIKIESLLYRIASFLQLKNYMQADEDCRHVLGEGLAKGEDAFRAVLCCM Predict reactive species Full Name: helicase with zinc finger Calculated Molecular Weight: 1942 aa, 219 kDa Observed Molecular Weight: 200 kDa GenBank Accession Number: BC130582 Gene Symbol: HELZ Gene ID (NCBI): 9931 RRID: AB_2880584 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P42694 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924