Proteintech, 26636-1-AP, CFDP1 Polyclonal antibody

Size: 20ul / 150ul The CFDP1 (26636-1-AP) by Proteintech is a Polyclonal antibody targeting CFDP1 in WB, ELISA applications with reactivity to human samples 26636-1-AP targets CFDP1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, HEK-293 cells Positive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24425 Product name: Recombinant human CFDP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 172-299 aa of BC000991 Sequence: AGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALPSLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDRVDHRQFEIERDLRLSKMKP Predict reactive species Full Name: craniofacial development protein 1 Calculated Molecular Weight: 299 aa, 34 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC000991 Gene Symbol: CFDP1 Gene ID (NCBI): 10428 RRID: AB_2880585 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UEE9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.