Product Description
Size: 20ul / 150ul
The TIMP2 (26647-1-AP) by Proteintech is a Polyclonal antibody targeting TIMP2 in IHC, ELISA applications with reactivity to human, mouse samples
26647-1-AP targets TIMP2 in IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive IHC detected in: mouse lung tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
The TIMPs are natural highly specific endogenous inhibitors of MMPs. Human TIMP family consists of four 21-28 kDa proteins known as TIMP1, TIMP2, TIMP3, and TIMP4 encoded by four paralogous genes.TIMPs are vital to the maintenance of ECM homeostasis primarily through their MMP inhibitory functions. TIMP2, a member of the TIMP family, regulates the proteolytic activity of all MMPs and is involved in cell differentiation, growth, migration, angiogenesis, and apoptosis. Urinary TIMP2 has been recently recognized as an early biomarker to predict Acute kidney injury (AKI) in critically ill patients.
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24436 Product name: Recombinant human TIMP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 82-220 aa of BC052605 Sequence: PEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP Predict reactive species
Full Name: TIMP metallopeptidase inhibitor 2
Calculated Molecular Weight: 220 aa, 24 kDa
GenBank Accession Number: BC052605
Gene Symbol: TIMP2
Gene ID (NCBI): 7077
RRID: AB_2880587
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P16035
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924