Proteintech, 26649-1-AP, PEX13 Polyclonal antibody

Size: 20ul / 150ul The PEX13 (26649-1-AP) by Proteintech is a Polyclonal antibody targeting PEX13 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 26649-1-AP targets PEX13 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24400 Product name: Recombinant human PEX13 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 253-403 aa of BC067090 Sequence: LLSTHSDEVTDSINWASGEDDHVVARAEYDFAAVSEEEISFRAGDMLNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRKGRKTVESSKVSKQQQSFTNPTLTKGATVADSLDEQEAAFESVFVETNKVPVAPDSIGKDGEKQDL Predict reactive species Full Name: peroxisomal biogenesis factor 13 Calculated Molecular Weight: 403 aa, 44 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC067090 Gene Symbol: PEX13 Gene ID (NCBI): 5194 RRID: AB_2880588 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92968 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.