Proteintech, 26651-1-AP, LIN37 Polyclonal antibody

Size: 20ul / 150ul The LIN37 (26651-1-AP) by Proteintech is a Polyclonal antibody targeting LIN37 in WB, IF/ICC, ELISA applications with reactivity to human samples 26651-1-AP targets LIN37 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information LIN37, also named as Antolefinin and MSTP064, is a component of the DREAM complex (also named LINC complex). LIN37 migrates to 37 kDa for modification. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24565 Product name: Recombinant human LIN37 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-93 aa of BC009071 Sequence: MFPVKVKVEKSELEMAKARNQLDAVLQCLLEKSHMDRERLDEEAGKTPSDTHNKDCSIAATGKRPSARFPHQRRKKRREMDDGLAEGGPQRSN Predict reactive species Full Name: lin-37 homolog (C. elegans) Observed Molecular Weight: 36 kDa GenBank Accession Number: BC009071 Gene Symbol: LIN37 Gene ID (NCBI): 55957 RRID: AB_2880590 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96GY3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.