Product Description
Size: 20ul / 150ul
The LIN37 (26651-1-AP) by Proteintech is a Polyclonal antibody targeting LIN37 in WB, IF/ICC, ELISA applications with reactivity to human samples
26651-1-AP targets LIN37 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: A549 cells, Jurkat cells
Positive IF/ICC detected in: A549 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
LIN37, also named as Antolefinin and MSTP064, is a component of the DREAM complex (also named LINC complex). LIN37 migrates to 37 kDa for modification.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24565 Product name: Recombinant human LIN37 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-93 aa of BC009071 Sequence: MFPVKVKVEKSELEMAKARNQLDAVLQCLLEKSHMDRERLDEEAGKTPSDTHNKDCSIAATGKRPSARFPHQRRKKRREMDDGLAEGGPQRSN Predict reactive species
Full Name: lin-37 homolog (C. elegans)
Observed Molecular Weight: 36 kDa
GenBank Accession Number: BC009071
Gene Symbol: LIN37
Gene ID (NCBI): 55957
RRID: AB_2880590
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q96GY3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924