Iright
BRAND / VENDOR: Proteintech

Proteintech, 26653-1-AP, ADAMTSL3 Polyclonal antibody

CATALOG NUMBER: 26653-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADAMTSL3 (26653-1-AP) by Proteintech is a Polyclonal antibody targeting ADAMTSL3 in IHC, ELISA applications with reactivity to human, mouse samples 26653-1-AP targets ADAMTSL3 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human placenta tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ADAMTSL3 (ADAMTS-Like Protein 3) is a member of the ADAMTSL family of matricellular proteins, which are involved in extracellular matrix (ECM) remodeling and regulation of various biological processes, including cardiac function, cartilage development, and inflammation. (PMID: 38324186) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24488 Product name: Recombinant human ADAMTSL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 616-720 aa of BC128389 Sequence: TERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATCLGGHQEAIAVCLHIQTQQTVNDSLCDMVHRPPAMSQACNTEPCPPRWHVGSWGPCSATCG Predict reactive species Full Name: ADAMTS-like 3 Calculated Molecular Weight: 1691 aa, 189 kDa GenBank Accession Number: BC128389 Gene Symbol: ADAMTSL3 Gene ID (NCBI): 57188 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P82987 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924