Iright
BRAND / VENDOR: Proteintech

Proteintech, 26665-1-AP, Calsequestrin 1 Polyclonal antibody

CATALOG NUMBER: 26665-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Calsequestrin 1 (26665-1-AP) by Proteintech is a Polyclonal antibody targeting Calsequestrin 1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 26665-1-AP targets Calsequestrin 1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse heart tissue Positive IHC detected in: human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24684 Product name: Recombinant human CASQ1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 35-91 aa of BC022289 Sequence: PEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQ Predict reactive species Full Name: calsequestrin 1 (fast-twitch, skeletal muscle) Calculated Molecular Weight: 390 aa, 45 kDa Observed Molecular Weight: 45 kDa, 63 kDa GenBank Accession Number: BC022289 Gene Symbol: Calsequestrin 1 Gene ID (NCBI): 844 RRID: AB_2880594 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31415 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924