Proteintech, 26691-1-AP, P3H1 Polyclonal antibody

Size: 20ul / 150ul The P3H1 (26691-1-AP) by Proteintech is a Polyclonal antibody targeting P3H1 in WB, IHC, ELISA applications with reactivity to human samples 26691-1-AP targets P3H1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human testis tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information P3H1 (prolyl 3-hydroxylase 1, also known as LEPRE1) is a member of the leprecan family of proteins, which also include P3H2, P3H3, CRTAP and SC56. Collagen prolyl hydroxylases are required for proper collagen biosynthesis, folding, and assembly. P3H1 is localized to the endoplasmic reticulum and has prolyl 3-hydroxylase activity catalyzing the post-translational formation of 3-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens, especially types IV and V. Mutations in this gene are associated with osteogenesis imperfecta type VIII. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24904 Product name: Recombinant human LEPRE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-109 aa of BC108311 Sequence: EVESEAGWGMVTPDLLFAEGTAAYARGDWPGVVLSMERALRSRAALRALRLRCRTQCAADFPWELDPDWSPSPAQASGAAALRDLSF Predict reactive species Full Name: leucine proline-enriched proteoglycan (leprecan) 1 Calculated Molecular Weight: 83 kDa Observed Molecular Weight: 83 kDa GenBank Accession Number: BC108311 Gene Symbol: LEPRE1/P3H1 Gene ID (NCBI): 64175 RRID: AB_2880605 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q32P28 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.