Product Description
Size: 20ul / 150ul
The BMPR1B (26696-1-AP) by Proteintech is a Polyclonal antibody targeting BMPR1B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
26696-1-AP targets BMPR1B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse colon tissue, rat colon tissue
Positive IHC detected in: rat ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: MCF-7 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
BMPR1B (Bone morphogenetic protein receptor type-1B) is also named as CDw293. BMPR1B belongs to the protein kinase superfamily. BMPR1B is on ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. BMPR1B is receptor for BMP7/OP-1 and GDF5. BMPR1B Positively regulates chondrocyte differentiation through GDF5 interaction.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24902 Product name: Recombinant human BMPR1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-57 aa of BC047773 Sequence: EDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMI Predict reactive species
Full Name: bone morphogenetic protein receptor, type IB
Calculated Molecular Weight: 57 kDa
Observed Molecular Weight: 50 kDa
GenBank Accession Number: BC047773
Gene Symbol: BMPR1B
Gene ID (NCBI): 658
RRID: AB_3085892
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O00238
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924