Proteintech, 26743-1-AP, CCNJL Polyclonal antibody

Size: 20ul / 150ul The CCNJL (26743-1-AP) by Proteintech is a Polyclonal antibody targeting CCNJL in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 26743-1-AP targets CCNJL in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25048 Product name: Recombinant human CCNJL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-52 aa of BC013353 Sequence: PALGQPATTLAQFQTPVQDLCLAYRDSLQAHRS Predict reactive species Full Name: cyclin J-like Calculated Molecular Weight: 435 aa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC013353 Gene Symbol: CCNJL Gene ID (NCBI): 79616 RRID: AB_3085900 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IV13 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.