Proteintech, 26758-1-AP, Cas9 Polyclonal antibody

Size: 20ul / 150ul The Cas9 (26758-1-AP) by Proteintech is a Polyclonal antibody targeting Cas9 in WB, IP, ELISA applications with reactivity to bacteria samples 26758-1-AP targets Cas9 in WB, IP, ELISA applications and shows reactivity with bacteria samples. Tested Applications Positive WB detected in: HeLa cells, A431 cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Cas9 (CRISPR associated protein 9) is an RNA-guided DNA endonuclease enzyme associated with the CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) adaptive immunity system in Streptococcus pyogenes. This antibody detects the sp Cas9.This antibody can recognize Cas9 protein with point mutations, such as dCas9 and nCas9. Specification Tested Reactivity: bacteria Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25281 Product name: Recombinant Cas9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-100 aa of NP_269215 Sequence: MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR Predict reactive species Full Name: Cas9 Calculated Molecular Weight: 160 kDa GenBank Accession Number: NP_269215 RRID: AB_2918109 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99ZW2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.