Proteintech, 26765-1-AP, mCherry Polyclonal antibody

Size: 150ul The mCherry (26765-1-AP) by Proteintech is a Polyclonal antibody targeting mCherry in WB, IF/ICC, IP, ELISA applications with reactivity to recombinant protein samples 26765-1-AP targets mCherry in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with recombinant protein samples. Tested Applications Positive WB detected in: Transfected HEK-293 cells, Recombinant protein Positive IP detected in: Transfected HEK-293T cells Positive IF/ICC detected in: Transfected HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Red fluorescent proteins (RFPs) is a collective term referring to a heterogenous group of red chromophore-carrying proteins, originating from various species and forming different protein lineages.The original RFP (dsRed) is a 225 amino acid fluorescent protein (25.9 kDa) derived fromDiscosoma sp.. It emits red light with a peak wavelength of 593 nm upon excitation by green light (excitation peak at 558 nm).When fused with other proteins, RFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy.This antibody is a rabbit polyclonal antibody raised against mCherry. It can be used to detect mCherry, dsRed, tdTomato, and mScarlet. Specification Tested Reactivity: recombinant protein Cited Reactivity: human, mouse, rabbit, monkey, zebrafish, yeast, plant, d. punctatus Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25320 Product name: Recombinant mCherry protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-235 aa of Sequence: VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK Predict reactive species Full Name: mCherry Calculated Molecular Weight: 27 kDa RRID: AB_2876881 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.