Iright
BRAND / VENDOR: Proteintech

Proteintech, 26767-1-AP, FCHO1 Polyclonal antibody

CATALOG NUMBER: 26767-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FCHO1 (26767-1-AP) by Proteintech is a Polyclonal antibody targeting FCHO1 in WB, IHC, ELISA applications with reactivity to human samples 26767-1-AP targets FCHO1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:800-1:3200 Background Information FCHO1 is composed of 889 amino acid residues and contains an N-terminal FES-CIP4 homology (FCH) domain and an evolutionarily conserved C-terminal FCHO homology (FOH) domain. FCHO1 functions in an early step of clathrin-mediated endocytosis. FCHO1 is required for plasma membrane clathrin-coated vesicle (CCV) budding and marked sites of CCV formation (PMID: 20448150). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25291 Product name: Recombinant human FCHO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 45-180 aa of BC028021 Sequence: ETYSKAMAKLSKLASNGTPMGTFAPLWEVFRVSSDKLALCHLELTRKLQDLIKDVLRYGEEQLKTHKKCKEEVVSTLDAVQVLSGVSQLLPKSRENYLNRCMDQERLRRESTSQKEMDKAETKTKKAAESLRRSVE Predict reactive species Full Name: FCH domain only 1 Calculated Molecular Weight: 97 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC028021 Gene Symbol: FCHO1 Gene ID (NCBI): 23149 RRID: AB_2880626 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14526 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924