Proteintech, 26769-1-AP, HNRPLL Polyclonal antibody

Size: 20ul / 150ul The HNRPLL (26769-1-AP) by Proteintech is a Polyclonal antibody targeting HNRPLL in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 26769-1-AP targets HNRPLL in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, K-562 cells Positive IHC detected in: mouse kidney tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information HNRPLL, also named as HNRNPLL and SRRF, is an RNA binding protein that regulates alternative splicing of pre-mRNA. HnRNPLL is up-regulated in stimulated T cells, bound CD45 transcripts, and is a key inducible regulator of CD45 alternative splicing (PMID: 18669861). HNRPLL has 5 isoforms with the molecular weights of 31-60 kDa. Additionally, studies have shown that HNRPLL is a metastasis suppressor gene in colorectal cancer (PMID: 28360095). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25287 Product name: Recombinant human HNRPLL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC017480 Sequence: MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHH Predict reactive species Full Name: heterogeneous nuclear ribonucleoprotein L-like Observed Molecular Weight: 60 kDa GenBank Accession Number: BC017480 Gene Symbol: HNRPLL Gene ID (NCBI): 92906 RRID: AB_2880628 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVV9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.