Proteintech, 26784-1-AP, GCGR Polyclonal antibody

Size: 20ul / 150ul The GCGR (26784-1-AP) by Proteintech is a Polyclonal antibody targeting GCGR in WB, IHC, ELISA applications with reactivity to human, mouse samples 26784-1-AP targets GCGR in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse heart tissue Positive IHC detected in: human liver tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Glucagon receptor (GCGR) is a secretin-like (class B) family of G-protein coupled receptors (GPCRs). It plays an important role in elevating the glucose concentration in the blood and has thus become one of the promising therapeutic targets for treating type 2 diabetes mellitus (PMID: 26236379). GCGR is a 62-kDa glycoprotein that contains at least four N-linked oligosaccharide chains (PMID: 2174441; 15245877). Defects in the gene of GCGR cause non-insulin-dependent diabetes mellitus (NIDDM). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24861 Product name: Recombinant human GCGR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 91-141 aa of BC104854 Sequence: VQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSF Predict reactive species Full Name: glucagon receptor Calculated Molecular Weight: 477 aa, 54 kDa Observed Molecular Weight: 62-68 kDa GenBank Accession Number: BC104854 Gene Symbol: GCGR Gene ID (NCBI): 2642 RRID: AB_2880634 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P47871 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.