Iright
BRAND / VENDOR: Proteintech

Proteintech, 26793-1-AP, SIPA1 Polyclonal antibody

CATALOG NUMBER: 26793-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SIPA1 (26793-1-AP) by Proteintech is a Polyclonal antibody targeting SIPA1 in WB, IHC, ELISA applications with reactivity to human samples 26793-1-AP targets SIPA1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, HEK-293T cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SIPA1 (Signal-induced proliferation-associated protein 1) is also named as SPA1, p130 SPA-1 and GTPase-activating protein Spa-1. SIPA1, a GTPase activating protein, was discovered in proliferating lymphocytes as mitogen-induced nuclear protein. SIPA1 promotes catalyzation of hydrolyze Rap1GTP/GDP and is known to be a negative regulator of Ras-related protein, which transduces the signals for various cellular functions, including development, cellular proliferation, and cellular adhesion (PMID:28237246). Transcription of fibronectin 1, which is crucial for cell junction and migration of triple-negative breast cancer (TNBC) cells, was regulated by SIPA1 in a DBR-dependent manner. SIPA1 was highly expressed in metastatic TNBC. SIPA1 served as a TF, promoting TNBC migration, invasion, and metastasis (PMID: 37500797). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25383 Product name: Recombinant human SIPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 950-1042 aa of BC010492 Sequence: GQPIPESGDPKGTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAESESAATRLLLASKQLGSPTADLA Predict reactive species Full Name: signal-induced proliferation-associated 1 Calculated Molecular Weight: 1042 aa, 112 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC010492 Gene Symbol: SIPA1 Gene ID (NCBI): 6494 RRID: AB_2880637 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96FS4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924