Iright
BRAND / VENDOR: Proteintech

Proteintech, 26810-1-AP, DTWD1 Polyclonal antibody

CATALOG NUMBER: 26810-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DTWD1 (26810-1-AP) by Proteintech is a Polyclonal antibody targeting DTWD1 in WB, ELISA applications with reactivity to human samples 26810-1-AP targets DTWD1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information DTW domain-containing protein 1 (DTWD1), also named as tRNA-uridine aminocarboxypropyltransferase 1, is responsible for 3-(3-amino-3-carboxypropyl)uridine modification at position 20 in the D-loop of certain tRNAs (PMID: 31804502; 37745798). DTWD1 has been identified as a target gene of p53 and functions as a tumor suppressor gene (PMID: 25973305). Dysregulated expression of DTWD1 has been reported in several malignancies, including gastric cancer and colorectal cancer (PMID: 25973305; 31924336). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25170 Product name: Recombinant human DTWD1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-304 aa of BC032535 Sequence: MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAIHAKLLAPEFVNIYTYPCIPEYEEKDHEVALIFPGPQSISIKDISFHLQKRIQNNVRGKNDDPDKPSFKRKRTEEQEFCDLNDSKCKGTTLKKIIFIDSTWNQTNKIFTDERLQGLLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTDILKEKYRGQYDNLLFFYSFMYQLIKNAKCSGDKETGKLTH Predict reactive species Full Name: DTW domain containing 1 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC032535 Gene Symbol: DTWD1 Gene ID (NCBI): 56986 RRID: AB_3085907 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N5C7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924