Proteintech, 26816-1-AP, CDK12/CRKRS Polyclonal antibody

Size: 20ul / 150ul The CDK12/CRKRS (26816-1-AP) by Proteintech is a Polyclonal antibody targeting CDK12/CRKRS in WB, IF/ICC, ELISA applications with reactivity to human samples 26816-1-AP targets CDK12/CRKRS in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, Jurkat cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information CRKRS (Cdc2-related kinase, Arg/Ser), also named as cyclin-dependent kinase 12 (CKD12), belongs to CDC2/CDKX subfamily. CDK12 can form a heterodimeric complex with its activating partner, cyclin K, to regulate important cellular physiological processes that include transcriptional regulation, regulation of DNA damage repair genes such as BRCA1 and ATM, suppression of intronic polyadenylation, and susceptibility to PARP inhibitors (PMID: 30487607, 24240700, 31694772). CDK12 has 3 isoforms with the calculated molecular mass of 164/163/141 kDa, and the apparent molecular mass of 180-200 kDa due to some modifications (PMID 11683387, 22988298). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25323 Product name: Recombinant human CRKRS protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1300-1481 aa of BC150265 Sequence: EAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSLSHLGESSSYQGTGSVQFPGDQDLRFARVPLALHPVVGQPFLKAEGSSNSVVHAETKLQNYGELGPGTTGASSSGAGLHWGGPTQSSAYGKLYRGPTRVPPRGGRGRGVPY Predict reactive species Full Name: Cdc2-related kinase, arginine/serine-rich Calculated Molecular Weight: 1490 aa, 164 kDa Observed Molecular Weight: 180-200 kDa GenBank Accession Number: BC150265 Gene Symbol: CDK12 Gene ID (NCBI): 51755 RRID: AB_2880645 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.