Proteintech, 26817-1-AP, WDR41 Polyclonal antibody

Size: 20ul / 150ul The WDR41 (26817-1-AP) by Proteintech is a Polyclonal antibody targeting WDR41 in WB, ELISA applications with reactivity to human samples 26817-1-AP targets WDR41 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information WDR41, or WD40 repeat-containing protein 41, is a protein that plays a role in regulating cellular processes, particularly in the context of neurodegenerative diseases such as amyotrophic lateral sclerosis (ALS) and frontotemporal dementia (FTD). It is part of a complex that includes C9ORF72 and SMCR8, which has been shown to regulate autophagy and function as a Rab GTPase-activating protein (GAP). The C9ORF72-SMCR8-WDR41 complex is believed to participate in the regulation of membrane trafficking and autophagy-lysosome pathway. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25275 Product name: Recombinant human WDR41 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 97-459 aa of BC040241 Sequence: ESCEEKNQLILTASADRTVIVWDGDTTRQVQRISCFQSTVKCLTVLQRLDVWLSGGNDLCVWNRKLDLLCKTSHLSDTGISALVEIPKNCVVAAVGKELIIFRLVAPTEGSLEWDILEVKRLLDHQDNILSLINVNDLSFVTGSHVGELIIWDALDWTMQAYERNFWDPSPQLDTQQEIKLCQKSNDISIHHFTCDEENVFAAVGRGLYVYSLQMKRVIACQKTAHDSNVLHVARLPNRQLISCSEDGSVRIWELREKQQLAAEPVPTGFFNMWGFGRVSKQASQPVKKQQENATSCSLELIGDLIGHSSSVEMFLYFEDHGLVTCSADHLIILWKNGERESGLRSLRLFQKLEENGDLYLAV Predict reactive species Full Name: WD repeat domain 41 Calculated Molecular Weight: 459 aa, 52 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC040241 Gene Symbol: WDR41 Gene ID (NCBI): 55255 RRID: AB_2880646 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HAD4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.