Proteintech, 26827-1-AP, SLC12A9 Polyclonal antibody

Size: 20ul / 150ul The SLC12A9 (26827-1-AP) by Proteintech is a Polyclonal antibody targeting SLC12A9 in WB, ELISA applications with reactivity to human, mouse samples 26827-1-AP targets SLC12A9 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, LNCaP cells, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SLC12A9, also known as CCC6 and CIP1, belongs to the SLC12A transporter family. SLC12A9 encodes a 914 amino acid protein with predicted 12 TM domains, two N-glycosylation sites between TM5 and TM6, and a carboxyl terminus PKC phosphorylation site (PMID: 23506871). SLC12A9 regulates ion gradients across renal tubules and maintains cell volume (PMID: 27530302). SLC12A9 is highly expressed in placenta, brain, and kidney. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25351 Product name: Recombinant human SLC12A9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 417-538 aa of BC000154 Sequence: QALLFHQVRKYLLRLDVRKDHVKFWRPQLLLLVGNPRGALPLLRLANQLKKGGLYVLGHVTLGDLDSLPSDPVQPQYGAWLSLVDRAQVKAFVDLTLSPSVRQGAQHLLRISGLESNSHPLP Predict reactive species Full Name: solute carrier family 12 (potassium/chloride transporters), member 9 Calculated Molecular Weight: 96 kDa Observed Molecular Weight: 101 kDa GenBank Accession Number: BC000154 Gene Symbol: SLC12A9 Gene ID (NCBI): 56996 RRID: AB_3085908 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXP2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.