Iright
BRAND / VENDOR: Proteintech

Proteintech, 26841-1-AP, FLVCR1 Polyclonal antibody

CATALOG NUMBER: 26841-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FLVCR1 (26841-1-AP) by Proteintech is a Polyclonal antibody targeting FLVCR1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 26841-1-AP targets FLVCR1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HepG2 cells, human placenta tissue, K-562 cells, mouse kidney tissue Positive IP detected in: K-562 cells Positive IHC detected in: human breast cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information FLVCR1(feline leukemia virus subgroup C receptor 1) has been reported to have a crucial role in a variety of biological processes, including cell proliferation, cell death, apoptosis, oxidative stress response, cellular differentiation, and metabolism (PMID: 29532854). In addition, FLVCR1 can be applied as a clinical prognostic marker for patients with ESCC (PMID: 33842377). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25220 Product name: Recombinant human FLVCR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC048312 Sequence: MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGPPRDSLAAASGVLGGPQTPLAPEEETQARLLPAGAGAETPGAESSPLPLTALSPRR Predict reactive species Full Name: feline leukemia virus subgroup C cellular receptor 1 Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60 kDa~70 kDa GenBank Accession Number: BC048312 Gene Symbol: FLVCR1 Gene ID (NCBI): 28982 RRID: AB_2880654 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5Y0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924