Iright
BRAND / VENDOR: Proteintech

Proteintech, 26846-1-AP, TRAF2 Polyclonal antibody

CATALOG NUMBER: 26846-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRAF2 (26846-1-AP) by Proteintech is a Polyclonal antibody targeting TRAF2 in WB, ELISA applications with reactivity to human samples 26846-1-AP targets TRAF2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, human testis tissue, Jurkat cells, MOLT-4 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Tumor necrosis factor (TNF) receptor-associated factor-2 (TRAF2) is one of the members of the TRAF superfamily protein, which is an intracellular junction protein with E3 ligase activity. TRAF2 mediates and regulates the activation of nuclear factor kappa B (NF-κB) and microtubule-associated protein kinase (MAPK) signaling pathways by binding to TNFR family proteins. Recent studies have demonstrated that TRAF2 regulates tumor progression through multiple pathways. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, bovine, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25387 Product name: Recombinant human TRAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 438-501 aa of BC032410 Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL Predict reactive species Full Name: TNF receptor-associated factor 2 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC032410 Gene Symbol: TRAF2 Gene ID (NCBI): 7186 RRID: AB_2880656 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12933 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924