Product Description
Size: 20ul / 150ul
The NOP14 (26854-1-AP) by Proteintech is a Polyclonal antibody targeting NOP14 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
26854-1-AP targets NOP14 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: MDA-MB-453s cells, BxPC-3 cells, MCF-7 cells, mouse lung tissue, rat kidney tissue
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25476 Product name: Recombinant human NOP14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-95 aa of BC026035 Sequence: MAKAKKVGARRKASGAPAGARGGPAKANSNPFEVKVNRQKFQILGRKTRHDVGLPGVSRARALRKRTQTLLKEYKERDKSNVFRDKRFGEYNSNM Predict reactive species
Full Name: NOP14 nucleolar protein homolog (yeast)
Calculated Molecular Weight: 98 kDa
Observed Molecular Weight: 98 kDa
GenBank Accession Number: BC026035
Gene Symbol: NOP14
Gene ID (NCBI): 8602
RRID: AB_2880657
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P78316
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924