Iright
BRAND / VENDOR: Proteintech

Proteintech, 26863-1-AP, RAF1 Polyclonal antibody

CATALOG NUMBER: 26863-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAF1 (26863-1-AP) by Proteintech is a Polyclonal antibody targeting RAF1 in WB, IHC, ELISA applications with reactivity to human samples 26863-1-AP targets RAF1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:600-1:2400 Background Information Raf-1 proto-oncogene, serine/threonine kinase(RAF1), is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. RAF1 has two isoforms with MW of 73, 75 kDa. RAF1 plays an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25423 Product name: Recombinant human RAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC018119 Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIR Predict reactive species Full Name: v-raf-1 murine leukemia viral oncogene homolog 1 Calculated Molecular Weight: 648 aa, 73 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC018119 Gene Symbol: RAF1 Gene ID (NCBI): 5894 RRID: AB_2880660 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04049 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924