Iright
BRAND / VENDOR: Proteintech

Proteintech, 26874-1-AP, SLC35A3 Polyclonal antibody

CATALOG NUMBER: 26874-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC35A3 (26874-1-AP) by Proteintech is a Polyclonal antibody targeting SLC35A3 in WB, ELISA applications with reactivity to human samples 26874-1-AP targets SLC35A3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, LNCaP cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SLC35A3, also named as UDP-N-acetylglucosamine transporter(NGT), is located to the Golgi apparatus. SLC35A3 can form heterologous complexes with SLC35A2(UGT) and Mgats in the Golgi membrane which may promote biosynthesis of complex N-glycans. It has been reported that the mutation of SLC35A3 is associsted with skeletal dysplasia and epilepsies which could result from impaired glycosylation of proteins. SLC35A3 has some isoforms with 32-36 kDa and 41 kDa.(PMID: 25944901, 28777481  , 16344554, 23583405) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25468 Product name: Recombinant human SLC35A3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 158-220 aa of BC005136 Sequence: SDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKETKQSVWIRNIQLVSFSLEPSL Predict reactive species Full Name: solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3 Calculated Molecular Weight: 325 aa, 36 kDa Observed Molecular Weight: 32-36 and 41 kDa GenBank Accession Number: BC005136 Gene Symbol: SLC35A3 Gene ID (NCBI): 23443 RRID: AB_2880665 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2D2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924