Product Description
Size: 20ul / 150ul
The AMPK Beta 1 (26907-1-AP) by Proteintech is a Polyclonal antibody targeting AMPK Beta 1 in WB, ELISA applications with reactivity to human, mouse, rat samples
26907-1-AP targets AMPK Beta 1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: A431 cells, Jurkat cells, NIH/3T3 cells, HeLa cells, PC-12 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Background Information
AMPK Beta 1 (5'-AMP-activated protein kinase subunit beta-1) is also named as PRKAB1 and AMPK. AMPK, a serine/threonine kinase that exists as a heterotrimer comprised of a catalytic α-subunit and regulatory β- and γ-subunits, has been recognized as a sensor of cellular energy homeostasis (PMID: 21937710). AMPK regulates key metabolic enzymes, cell growth, apoptosis, gene transcription, and protein synthesis (PMID: 12829246). AMPK is an energy sensor and plays an essential role in the control of cellular bioenergetics by responding to various stresses including those that induce changes in the cellular AMP:ATP ratio or modulation in intracellular calcium (PMID: 27812976, PMID: 26616193). Recent studies have shown that AMPK mediates the inhibition of cell proliferation and growth of tumor cells (PMID: 16613876). AMPK also inhibits the expression of Glut1 and glycolysis in Tregs by inhibiting mTORC1 signaling (PMID: 25477880).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25534 Product name: Recombinant human PRKAB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC001056 Sequence: MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN Predict reactive species
Full Name: protein kinase, AMP-activated, beta 1 non-catalytic subunit
Calculated Molecular Weight: 30 kDa
Observed Molecular Weight: 38 kDa
GenBank Accession Number: BC001056
Gene Symbol: PRKAB1
Gene ID (NCBI): 5564
RRID: AB_2880679
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9Y478
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924