Proteintech, 26910-1-AP, DUSP7/PYST2 Polyclonal antibody

Size: 20ul / 150ul The DUSP7/PYST2 (26910-1-AP) by Proteintech is a Polyclonal antibody targeting DUSP7/PYST2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 26910-1-AP targets DUSP7/PYST2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat heart tissue, mouse heart tissue, mouse kidney tissue Positive IHC detected in: human breast cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Human dual-specificity phosphatase 7 (DUSP7/PYST2) is a member of a structurally homologous subfamily of MAP kinase phosphatases. DUSP7 is overexpressed in myeloid leukemia and other malignancies. It is known to bind and dephosphorylate ErkII, and as it, along with the other members of the DUSP family expresses high selectively for MAP kinases. It has been suggested that it functions as a method for selectively activating/deactivating different members of that family. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25488 Product name: Recombinant human DUSP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-102 aa of BC104880 Sequence: IRSIIPNHADKERFATRCKAATVLLYDEATAEWQPEPGAPASV Predict reactive species Full Name: dual specificity phosphatase 7 Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC104880 Gene Symbol: DUSP7 Gene ID (NCBI): 1849 RRID: AB_2880681 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16829 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.