Proteintech, 26927-1-AP, Sa Cas9 Polyclonal antibody

Size: 20ul / 150ul The Sa Cas9 (26927-1-AP) by Proteintech is a Polyclonal antibody targeting Sa Cas9 in WB, ELISA applications with reactivity to Staphylococcus aureus samples 26927-1-AP targets Sa Cas9 in WB, ELISA applications and shows reactivity with Staphylococcus aureus samples. Tested Applications Positive WB detected in: Recombinant protein Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Cas9 (CRISPR associated protein 9) is an RNA-guided DNA endonuclease enzyme associated with the CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) adaptive immunity system in Streptococcus pyogenes (Sp). This antibody detects the Cas9 of Staphylococcus aureus (SaCas9). It can't detect the SpCas9. Specification Tested Reactivity: Staphylococcus aureus Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25669 Product name: Recombinant Sa Cas9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of Sequence: MKRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRRRRHRIQRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQKL Predict reactive species Full Name: Sa Cas9 RRID: AB_2880688 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.