Proteintech, 26951-1-AP, Perilipin 5 Polyclonal antibody

Size: 20ul / 150ul The Perilipin 5 (26951-1-AP) by Proteintech is a Polyclonal antibody targeting Perilipin 5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 26951-1-AP targets Perilipin 5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: MCF-7 cells, mouse liver tissue, pig heart tissue, mouse heart tissue, rat heart tissue Positive IHC detected in: human liver tissue, mouse heart tissue, mouse brown adipose tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Perilipin 5 (also known as LSDP5/OXPAT) is a lipid droplet (LD) coat protein that promotes association of LDs with mitochondria and is mainly present in tissues with a high fat-oxidative capacity, such as heart, skeletal muscles and brown adipose tissue. It plays an important role in the regulation of cardiac lipid storage and function. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25272 Product name: Recombinant human LSDP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-463 aa of BC131524 Sequence: ILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWEAEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELDF Predict reactive species Full Name: lipid storage droplet protein 5 Calculated Molecular Weight: 463 aa, 51 kDa Observed Molecular Weight: 51-55 kDa GenBank Accession Number: BC131524 Gene Symbol: Perilipin 5 Gene ID (NCBI): 440503 RRID: AB_2880699 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q00G26 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.