Proteintech, 26971-1-AP, DNMT3B Polyclonal antibody

Size: 20ul / 150ul The DNMT3B (26971-1-AP) by Proteintech is a Polyclonal antibody targeting DNMT3B in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 26971-1-AP targets DNMT3B in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, MCF-7 cells, Jurkat cells Positive IP detected in: K-562 cells Positive IHC detected in: mouse brain tissue, human breast cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DNMT3B is a DNA-(cytosine C5)-methyltransferase that is responsible for establishing the methylation patterns in cooperation with DNMT3A through the de novo methylation pathway. It is essential for the establishment of DNA methylation patterns during development. DNMT3B contains a C-terminal catalytic domain and an N-terminal regulatory domain, which are involved in targeting chromatin to regulate its function (PMID: 31547729). DNMT3B has 8 isoforms with the molecular mass of 80-96 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25117 Product name: Recombinant human DNMT3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001207055 Sequence: MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSES Predict reactive species Full Name: DNA (cytosine-5-)-methyltransferase 3 beta Calculated Molecular Weight: 95 kDa Observed Molecular Weight: 85-96 kDa GenBank Accession Number: NM_001207055 Gene Symbol: DNMT3B Gene ID (NCBI): 1789 RRID: AB_2880705 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBC3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.