Iright
BRAND / VENDOR: Proteintech

Proteintech, 26974-1-AP, ELMO1 Polyclonal antibody

CATALOG NUMBER: 26974-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ELMO1 (26974-1-AP) by Proteintech is a Polyclonal antibody targeting ELMO1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 26974-1-AP targets ELMO1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse brain tissue, rat brain tissue Positive IHC detected in: mouse spleen tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: K-562 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ELMO1 (Engulfment and cell motility protein 1) is a cytoplasmic adapter protein that physically associates with members of the Dock-A family of Rac-GEFs, of which Dock1 and Dock2 are the best characterized (PMID: 24821968). ELMO1 is expressed in platelets and negatively regulates integrin-mediated platelet spreading. Upregulated ELMO1 expression is associated with a poor prognosis in hepatocellular carcinoma (HCC), as well as increased cell growth, invasion, migration, angiogenesis and EMT in vitro and in vivo (PMID: 31324602). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25635 Product name: Recombinant human ELMO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 76-158 aa of BC114341 Sequence: RLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEFINLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFT Predict reactive species Full Name: engulfment and cell motility 1 Observed Molecular Weight: 80~84 kDa GenBank Accession Number: BC114341 Gene Symbol: ELMO1 Gene ID (NCBI): 9844 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92556 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924