Proteintech, 26979-1-AP, Cystatin S Polyclonal antibody

Size: 20ul / 150ul The Cystatin S (26979-1-AP) by Proteintech is a Polyclonal antibody targeting Cystatin S in WB, IHC, ELISA applications with reactivity to human samples 26979-1-AP targets Cystatin S in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human saliva tissue Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information Cystatins are a family of inhibitors of cysteine peptidases that comprises the salivary cystatins D and S-type (including CST5 and CST4,1,2) and cystatin C-type (CST3) (PMID: 25329717). The D and S-type cystatin have also been detected in seminal plasma, tears, and tracheobronchial fluid but not in other fluids and secretions where cystatin C is found. And the CST4 was expressed in the serous acinar and demilune cells of the human submandibular gland and at lower levels in the serous acini of the parotid gland (PMID:11879580). CST4 specifically combines with cysteine protease to regulate its activity, thus preventing hydrolysis of the extracellular matrix. And some studies propose that CST4 might be a biomarker for gastrointestinal cancer (PMID:29218251; PMID:29636621). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25619 Product name: Recombinant human CST4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 103-141 aa of BC065714 Sequence: TCAFHEQPELQKKQLCSFEIYEVPWEDRMSLVNSRCQEA Predict reactive species Full Name: cystatin S Observed Molecular Weight: 16 kDa GenBank Accession Number: BC065714 Gene Symbol: Cystatin S Gene ID (NCBI): 1472 RRID: AB_2880710 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01036 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.