Proteintech, 27009-1-AP, Nurim Polyclonal antibody

Size: 20ul / 150ul The Nurim (27009-1-AP) by Proteintech is a Polyclonal antibody targeting Nurim in WB, ELISA applications with reactivity to human, rat samples 27009-1-AP targets Nurim in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells, HSC-T6 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25501 Product name: Recombinant human NRM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC039865 Sequence: MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSILAPLAWDLGLLLLFVGQHSLMAAERVKAWTSRYFGVLQR Predict reactive species Full Name: nurim (nuclear envelope membrane protein) Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC039865 Gene Symbol: NRM Gene ID (NCBI): 11270 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IXM6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.