Iright
BRAND / VENDOR: Proteintech

Proteintech, 27011-1-AP, PEX12 Polyclonal antibody

CATALOG NUMBER: 27011-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PEX12 (27011-1-AP) by Proteintech is a Polyclonal antibody targeting PEX12 in WB, ELISA applications with reactivity to human samples 27011-1-AP targets PEX12 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, A549 cells, HeLa cells, HepG2 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Peroxisome assembly protein 12 (PEX12), also known as Peroxisome assembly factor 3 (PAF-3), is an integral peroxisomal membrane protein that is essential for peroxisomal matrix protein import and is one of only two peroxins known to interact with the ligand-binding domain of PEX5. Mutations in human PEX12 result in Zellweger syndrome, a lethal neurological disorder, and implicate the zinc ring domain in PEX12 function (PMID: 12456682). Pex12 exhibits protein-Ub ligase activity with specificity for the E2 protein Pex4 and Ubc4 (PMID: 19687296). Specification Tested Reactivity: human Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25500 Product name: Recombinant human PEX12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC031085 Sequence: MAEHGAHFTAASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLAESNPTHYGFLWRWFDEIFTLLDLLLQQHYLSRTSASFSENFYGLKRIVMGDTHKSQRLASAGLPKQQLWKSIMFLVLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKR Predict reactive species Full Name: peroxisomal biogenesis factor 12 Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 40-42 kDa GenBank Accession Number: BC031085 Gene Symbol: PEX12 Gene ID (NCBI): 5193 RRID: AB_2880720 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00623 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924