Proteintech, 27013-1-AP, TRIM26 Polyclonal antibody

Size: 20ul / 150ul The TRIM26 (27013-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM26 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 27013-1-AP targets TRIM26 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, mouse testis tissue, RAW 264.7 cells, HeLa cells, HepG2 cells Positive IP detected in: HeLa cells Positive IHC detected in: human pancreas cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TRIM26 is a member of the tripartite motif (TRIM) protein family composed of more than 70 members in human. TRIM proteins share a similar characteristic structure, which includes a RING (R) domain, one or two B-boxes (B), and a coiled coil (CC) domain in the N-terminal and a domain in the C-terminal with variable structures. TRIM26 potentiates virus-triggered IRF3, NF-κB activation, IFN-β induction, and cellular antiviral responses. Further investigation suggests that TRIM26 plays an important role in the antiviral innate immune response by bridging TBK1 to NEMO and mediating TBK1 activation. (PMID: 25763818, PMID: 26611359) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25546 Product name: Recombinant human TRIM26 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-270 aa of BC024039 Sequence: NHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQDTRDFLNRYPRKKFW Predict reactive species Full Name: tripartite motif-containing 26 Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC024039 Gene Symbol: TRIM26 Gene ID (NCBI): 7726 RRID: AB_2880721 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12899 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.