Product Description
Size: 20ul / 150ul
The SH3GL1 (27014-1-AP) by Proteintech is a Polyclonal antibody targeting SH3GL1 in WB, ELISA applications with reactivity to human, mouse, rat samples
27014-1-AP targets SH3GL1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: rat brain tissue, mouse brain tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25550 Product name: Recombinant human SH3GL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 233-313 aa of BC001270 Sequence: LDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKA Predict reactive species
Full Name: SH3-domain GRB2-like 1
Calculated Molecular Weight: 41 kDa
Observed Molecular Weight: 41-43 kDa
GenBank Accession Number: BC001270
Gene Symbol: SH3GL1
Gene ID (NCBI): 6455
RRID: AB_2880722
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q99961
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924