Proteintech, 27035-1-AP, PI3 Kinase p55 Gamma Polyclonal antibody

Size: 20ul / 150ul The PI3 Kinase p55 Gamma (27035-1-AP) by Proteintech is a Polyclonal antibody targeting PI3 Kinase p55 Gamma in WB, IHC, ELISA applications with reactivity to human, mouse samples 27035-1-AP targets PI3 Kinase p55 Gamma in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, HUVEC cells, HEK-293 cells Positive IHC detected in: human kidney tissue, mouse testis tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PIK3R3, also named as p55PIK, belongs to the PI3K p85 subunit family. It binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During INS stimulation, it also binds to IRS-1. It is a component of a heterodimer of p110 (catalytic) and p55 (regulatory) subunits. The antibody is specific to PIK3R3. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25884 Product name: Recombinant human PIK3R3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 312-382 aa of BC021622 Sequence: HLVWLNHKGVRQKRLNVWLGIKNEDAAENYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGAFLI Predict reactive species Full Name: phosphoinositide-3-kinase, regulatory subunit 3 (gamma) Calculated Molecular Weight: 85 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC021622 Gene Symbol: PI3 Kinase p55 Gamma Gene ID (NCBI): 8503 RRID: AB_2880730 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92569 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.