Proteintech, 27056-1-AP, FBP17 Polyclonal antibody

Size: 20ul / 150ul The FBP17 (27056-1-AP) by Proteintech is a Polyclonal antibody targeting FBP17 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 27056-1-AP targets FBP17 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human lung cancer tissue, human breast cancer tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:150-1:600 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FBP17 (formin-binding protein 17) is a new dynamin-associating molecule consisting of several functional domains, including an N-terminal EFC domain and an SH3 domain at the C-terminus. FBP17 is involved in dynamin-mediated endocytosis and has been reported to be required for invadopodia formation and tumor cell invasion. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25784 Product name: Recombinant human FNBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 176-241 aa of BC101755 Sequence: AQIRHQMAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQV Predict reactive species Full Name: formin binding protein 1 Observed Molecular Weight: 80-85 kDa GenBank Accession Number: BC101755 Gene Symbol: FBP17 Gene ID (NCBI): 23048 RRID: AB_2880734 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96RU3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.