Iright
BRAND / VENDOR: Proteintech

Proteintech, 27071-1-AP, RAD21 Polyclonal antibody

CATALOG NUMBER: 27071-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAD21 (27071-1-AP) by Proteintech is a Polyclonal antibody targeting RAD21 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, canine samples 27071-1-AP targets RAD21 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, canine samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, MDCK cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information RAD21, also named as Nuclear matrix protein 1, is a 631 amino acid protein, which belongs to the rad21 family. The calculated molecular weight of RAD21 is 72 kDa, but the phosphorylated RAD21 is about 120 kDa. The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad21, a gene involved in the repair of DNA double-strand breaks, as well as in chromatid cohesion during mitosis. This protein is a nuclear phospho-protein, which becomes hyperphosphorylated in cell cycle M phase. The highly regulated association of this protein with mitotic chromatin specifically at the centromere region suggests its role in sister chromatid cohesion in mitotic cells Specification Tested Reactivity: human, canine Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25481 Product name: Recombinant human RAD21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 147-349 aa of BC050381 Sequence: EEVGNISILQENDFGDFGMDDREIMREGSAFEDDDMLVSTTTSNLLLESEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDDPPALSEAGVMLPEQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVT Predict reactive species Full Name: RAD21 homolog (S. pombe) Calculated Molecular Weight: 631 aa, 72 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC050381 Gene Symbol: RAD21 Gene ID (NCBI): 5885 RRID: AB_2880742 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60216 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924