Iright
BRAND / VENDOR: Proteintech

Proteintech, 27077-1-AP, NIPA1 Polyclonal antibody

CATALOG NUMBER: 27077-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NIPA1 (27077-1-AP) by Proteintech is a Polyclonal antibody targeting NIPA1 in WB, ELISA applications with reactivity to human, Mouse, Rat samples 27077-1-AP targets NIPA1 in WB, ELISA applications and shows reactivity with human, Mouse, Rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Nonimprinted in Prader-Willi/Angelman loci 1 (NIPA1, also known as SPG6) gene is located in the pericentromeric region of chromosome 15q and encodes a magnesium transporter located in the plasma membrane and early endosomes, implicated in neuronal development and maintenance (PMID: 17166836). NIPA1 is highly conserved along phylogeny and highly expressed in neuronal tissues. Specification Tested Reactivity: human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23847 Product name: Recombinant human NIPA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 194-277 aa of BC025678 Sequence: RYINKALECFDSSVFGAIYYVVFTTLVLLASAILFREWSNVGLVDFLGMACGFTTVSVGIVLIQVFKEFNFNLGEMNKSNMKTD Predict reactive species Full Name: non imprinted in Prader-Willi/Angelman syndrome 1 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC025678 Gene Symbol: NIPA1 Gene ID (NCBI): 123606 RRID: AB_3085923 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7RTP0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924