Proteintech, 27080-1-AP, DKK4 Polyclonal antibody

Size: 20ul / 150ul The DKK4 (27080-1-AP) by Proteintech is a Polyclonal antibody targeting DKK4 in WB, IHC, ELISA applications with reactivity to human, mouse samples 27080-1-AP targets DKK4 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse cerebellum tissue Positive IHC detected in: human oesophagus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24209 Product name: Recombinant human DKK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-152 aa of BC107047 Sequence: LVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFDCG Predict reactive species Full Name: dickkopf homolog 4 (Xenopus laevis) Calculated Molecular Weight: 224 aa, 25 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC107047 Gene Symbol: DKK4 Gene ID (NCBI): 27121 RRID: AB_2880746 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBT3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.