Iright
BRAND / VENDOR: Proteintech

Proteintech, 27081-1-AP, TTPA Polyclonal antibody

CATALOG NUMBER: 27081-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TTPA (27081-1-AP) by Proteintech is a Polyclonal antibody targeting TTPA in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27081-1-AP targets TTPA in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24177 Product name: Recombinant human TTPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 218-278 aa of BC058000 Sequence: IKERIHMHGNNYKQSLLQHFPDILPLEYGGEEFSMEDICQEWTNFIMKSEDYLSSISESIQ Predict reactive species Full Name: tocopherol (alpha) transfer protein Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 29-32 kDa GenBank Accession Number: BC058000 Gene Symbol: TTPA Gene ID (NCBI): 7274 RRID: AB_2880747 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49638 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924