Proteintech, 27099-1-AP, RUNX3 Polyclonal antibody

Size: 20ul / 150ul The RUNX3 (27099-1-AP) by Proteintech is a Polyclonal antibody targeting RUNX3 in WB, ELISA applications with reactivity to human samples 27099-1-AP targets RUNX3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information RUNX3, also known as AML2, CBFA3 and PEBP2A3, is a member of the RUNX family of transcription factors, which are crucial regulators of embryonic development and play key roles in various biological processes such as cell proliferation, apoptosis, differentiation and lineage commitment (PMID: 38430423). This protein functions as a tumour suppressor and is frequently deleted or transcriptionally silenced in various cancers, including gastric and colon cancer. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24339 Product name: Recombinant human RUNX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 207-251 aa of BC013362 Sequence: PFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTS Predict reactive species Full Name: runt-related transcription factor 3 Calculated Molecular Weight: 44 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC013362 Gene Symbol: RUNX3 Gene ID (NCBI): 864 RRID: AB_2880754 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13761 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.