Proteintech, 27102-1-AP, LIMPII Polyclonal antibody

Size: 20ul / 150ul The LIMPII (27102-1-AP) by Proteintech is a Polyclonal antibody targeting LIMPII in WB, IHC, ELISA applications with reactivity to human, mouse samples 27102-1-AP targets LIMPII in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, mouse liver tissue, NIH/3T3 cells, Y79 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25908 Product name: Recombinant human LIMPII protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-433 aa of BC021892 Sequence: NGTDGDSFHPLITKDEVLYVFPSDFCRSVYITFSDYESVQGLPAFRYKVPAEILANTSDNAGFCIPEGNCLGSGVLNVSICKNGAPIIMSFPHFYQADERFVSAIEGMHPNQEDHETFVDINPLTGIILKAAKRFQINIYVKKLDDFVETGDIRTMVFPVMYLNESVHIDKETASRLKSMINTTL Predict reactive species Full Name: scavenger receptor class B, member 2 Calculated Molecular Weight: 478 aa, 54 kDa Observed Molecular Weight: 75-85 kDa GenBank Accession Number: BC021892 Gene Symbol: SCARB2 Gene ID (NCBI): 950 RRID: AB_2880756 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14108 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.